PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C017292P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 308aa    MW: 33279.1 Da    PI: 7.4134
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C017292P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding31.63.8e-10860447
                     S-HHHHHHHHHHHHHTTTT..........-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  4 WTteEdellvdavkqlGgg..........tWktIartmgkgRtlkqcksrwqky 47
                     WT+eEd+ + +a++ + g+           W++Ia++++  +  +++k ++q++
   MELO3C017292P1  8 WTKEEDKAFENAIATHWGEelegskgseeMWEKIASMVP-SKNMEDLKQHYQML 60
                     ****************999********************.************86 PP

2Myb_DNA-binding38.92e-12142186347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++ +  ++G+g+W++I+r +   Rt+ q+ s+ qky
   MELO3C017292P1 142 PWTEEEHRLFLLGLDKFGKGDWRSISRNFVISRTPTQVASHAQKY 186
                      7*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007174.7E-6463IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-5761IPR009057Homeodomain-like
PfamPF002494.0E-7760IPR001005SANT/Myb domain
SuperFamilySSF466891.51E-8766IPR009057Homeodomain-like
PROSITE profilePS500906.771861IPR017877Myb-like domain
CDDcd001671.80E-8861No hitNo description
PROSITE profilePS5129416.873135191IPR017930Myb domain
SuperFamilySSF466897.9E-17137192IPR009057Homeodomain-like
TIGRFAMsTIGR015574.3E-17139189IPR006447Myb domain, plants
SMARTSM007172.3E-10139189IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.6E-11140185IPR009057Homeodomain-like
PfamPF002497.6E-11142186IPR001005SANT/Myb domain
CDDcd001671.07E-9142187No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MSTGSAVWTK EEDKAFENAI ATHWGEELEG SKGSEEMWEK IASMVPSKNM EDLKQHYQML  60
VDDVGAIEAG QIPIPNYASS VGEETASTKE KDHHLHPHGA SDSNKRPNSG FGSGFSGLSH  120
DSSAHATKGG SRSEQERRKG IPWTEEEHRL FLLGLDKFGK GDWRSISRNF VISRTPTQVA  180
SHAQKYFIRL NSMNRDRRRS SIHDITSVNN GGGGDVMSHQ APITGHQTNG TNQSNPPALG  240
PPGKHRPQQH LPGIGMYGAP VGQPVAAPPG HIASAVGTPV MLPQGIHPHP PYVMPVAYPM  300
APPPMHQ*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00191DAPTransfer from AT1G49010Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818130.0LN681813.1 Cucumis melo genomic scaffold, anchoredscaffold00030.
GenBankLN7132560.0LN713256.1 Cucumis melo genomic chromosome, chr_2.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008453372.10.0PREDICTED: transcription factor DIVARICATA
TrEMBLA0A0A0LS090.0A0A0A0LS09_CUCSA; Uncharacterized protein
STRINGPGSC0003DMT4000143501e-138(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF106943340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G49010.13e-67MYB family protein